Huwentoxin-XVI
⚡ Custom Synthesis 🔬 HPLC & MS Certified 🌍 Global Delivery

Huwentoxin-XVI

Huwentoxin-XVI – Ion Channels and Transporters Huwentoxin-XVI is a 39 amino acids peptide that was discovered from the venom of the Chinese tarantula Ornithoctonus huwena. Huwentoxin-XVI was shown to be a potent blocker of HVA N-type calcium channels with an IC50 value of 60 nM in rat DRG. The blocking effect appears to be similar […]

Technical Specifications

Sequence:H-CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK-OH (Cys1-Cys16; Cys8-Cys21; Cys15-Cys36)
Purity:> 95% (by HPLC)
Counter-Ion:TFA Salts
Delivery Format:Lyophilized



Product Description & Background

Huwentoxin-XVI – Ion Channels and Transporters

Huwentoxin-XVI is a 39 amino acids peptide that was discovered from the venom of the Chinese tarantula Ornithoctonus huwena. Huwentoxin-XVI was shown to be a potent blocker of HVA N-type calcium channels with an IC50 value of 60 nM in rat DRG. The blocking effect appears to be similar to that of ω-conotoxin-GVIA and ω-conotoxin-MVIIA. Neverthelss, Huwentoxin-XVI differs from GVIA and MVIIA thanks to its greater reversibility and its higher selectivity for N-type over P/Q type than MVIIA.

 

Technical specification

Sequence : H-CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK-OH (Cys1-Cys16; Cys8-Cys21; Cys15-Cys36)
MW : 4437.11 g/mol
Purity : > 95%
Counter-Ion : TFA Salts
Delivery format : Lyophilized

Price

 

Product Size Price € Price $
HWT016-0.1 mg 0.1 mg 198€ 238$
HWT016-0.5 mg 0.5 mg 578€ 694$
HWT016-1 mg 1 mg 985€ 1182$

If you’d like to learn more about this toxin, visit our product page on our Genpabio website—Our sister company specializing in the synthesis of complex toxins.