Cy3-Crotamine
⚡ Custom Synthesis 🔬 HPLC & MS Certified 🌍 Global Delivery

Cy3-Crotamine

Cy3-Crotamine – Ion Channels and Transporters Cy3-crotamine is a fluorescent version of Crotamine which is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types such as tumor cells. Moreover, it has been reported that […]

Technical Specifications

Sequence:Cy3-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH (Cys4-Cys36; Cys11-Cys30; Cys18-Cys37)
Purity:> 95% (by HPLC)
Counter-Ion:TFA Salts
Delivery Format:Lyophilized



Product Description & Background

Cy3-Crotamine – Ion Channels and Transporters

Cy3-crotamine is a fluorescent version of Crotamine which is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types such as tumor cells. Moreover, it has been reported that crotamine is a blocker of Kv1.3 (IC50 around 300 nM) as well as Kv1.1 and Kv1.2. It has analgesic properties and myonecrotic effects. In addition, crotamine belongs to the beta-defensin peptides and as such demonstrates antibacterial properties by interacting with lipid membranes.

 

Technical specification

Sequence : Cy3-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH (Cys4-Cys36; Cys11-Cys30; Cys18-Cys37)
MW : 4883.82 g/mol
Purity : > 95%
Counter-Ion : TFA Salts
Delivery format : Lyophilized

Price

 

Product Size Price € Price $
CRO002-0.1 mg 0.1 mg 330€ 396$
CRO002-0.5 mg 0.5 mg 1045€ 1254$
CRO002-5 x 0.01 mg 5 x 0.01 mg 198€ 238$

If you’d like to learn more about this toxin, visit our product page on our Genpabio website—Our sister company specializing in the synthesis of complex toxins.