Crotamine – Ion Channels and Transporters
Crotamine is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types. Moreover, it has been reported that crotamine is a blocker of Kv1.3 (IC50 around 300 nM) as well as Kv1.1 and Kv1.2. It has analgesic properties and myonecrotic effects. In addition, crotamine belongs to the beta-defensin peptides and as such demonstrates antibacterial properties by interacting with lipid membranes.
Technical specification
| Sequence : | H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH (Cys4-Cys36; Cys11-Cys30; Cys18-Cys37) | |
| MW : | 4883.82 g/mol | |
| Purity : | > 95% | |
| Counter-Ion : | TFA Salts | |
| Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| CRO001-0.1 mg | 0.1 mg | 198€ | 238$ |
| CRO001-0.5 mg | 0.5 mg | 578€ | 694$ |
| CRO001-1 mg | 1 mg | 985€ | 1182$ |
If you’d like to learn more about this toxin, visit our product page on our Genpabio website—Our sister company specializing in the synthesis of complex toxins.
