⚡ Custom Synthesis🔬 HPLC & MS Certified🌍 Global Delivery
Scrambled LL-37 peptide
Scrambled LL-37 peptide – Potent antimicrobial peptide The scrambled version of LL-37 peptide is available. Scrambled LL-37 has the same peptide sequence as LL-37 peptide but has lost its helixforming property. Scrambled LL-37 can be used as a negative control of LL-37 studies. (See section “LL-37” ) Technical specification Sequence : GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR MW : […]
The scrambled version of LL-37 peptide is available.
Scrambled LL-37 has the same peptide sequence as LL-37 peptide but has lost its helixforming property. Scrambled LL-37 can be used as a negative control of LL-37 studies. (See section “LL-37” )
BACKGROUND: The pulmonary mucus of cystic fibrosis (CF) patients displays elevated levels of the cathelicidin antimicrobial peptide LL-37.
OBJECTIVE: Assess the effect of LL-37 on the growth of Aspergillus fumigatus,a common pathogen of CF patients.
METHOD/RESULTS: Exposure of A. fumigatus to LL-37 and its derived fragment RK-31 (1.95 μg/ml) for 24 h had a positive effect on growth (199.94% ± 6.172% [P < 0.05] and 218.20% ± 4.63% [P < 0.05],respectively),whereas scrambled LL-37 peptide did not (85.12% ± 2.92%). Exposure of mycelium (preformed for 24 h) to 5 μg/ml intact LL-37 for 48 h increased hyphal wet weight (4.37 ± 0.23 g , P < 0.001) compared to the control (2.67 ± 0.05 g) and scrambled LL-37 (2.23 ± 0.09 g) treatments. Gliotoxin secretion from LL-37 exposed hyphae (169.1 ± 6.36 ng/mg hyphae , P < 0.05) was increased at 24 h compared to the results seen with the control treatment (102 ± 18.81 ng/mg hyphae) and the scrambled LL-37 treatment (96.09 ± 15.15 ng/mg hyphae). Shotgun proteomic analysis of 24-h LL-37-treated hyphae revealed an increase in the abundance of proteins associated with growth (eukaryotic translation initiation factor 5A [eIF-5A] [16.3-fold increased]),tissue degradation (aspartic endopeptidase [4.7-fold increased]),and allergic reactions (Asp F13 [10-fold increased]). By 48 h,there was an increase in protein levels indicative of cellular stress (glutathione peroxidase [9-fold increased]),growth (eIF-5A [6-fold increased]),and virulence (RNase mitogillin [3.7-fold increased]).
CONCLUSION: These results indicate that LL-37 stimulates A. fumigatus growth and that this stimulation can result in increased fungal growth and secretion of toxins in the lungs of CF patients.T
