Scrambled LL-37 peptide
⚡ Custom Synthesis 🔬 HPLC & MS Certified 🌍 Global Delivery

Scrambled LL-37 peptide

Scrambled LL-37 peptide – Potent antimicrobial peptide The scrambled version of LL-37 peptide is available. Scrambled LL-37 has the same peptide sequence as LL-37 peptide but has lost its helixforming property. Scrambled LL-37 can be used as a negative control of LL-37 studies. (See section “LL-37” )   Technical specification Sequence : GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR MW : […]

Technical Specifications




Product Description & Background

Scrambled LL-37 peptide – Potent antimicrobial peptide

The scrambled version of LL-37 peptide is available.

Scrambled LL-37 has the same peptide sequence as LL-37 peptide but has lost its helixforming property.
Scrambled LL-37 can be used as a negative control of LL-37 studies.
(See section “LL-37” )

 

Technical specification

LL-37 scrambled peptide buy Sequence : GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Scrambled LL-37 peptide synthesis MW : 4 493.4 Da (C205H340N60O53)
LL-37 scrambled peptide price Purity : > 95%
Peptide Library synthesis service Counter-Ion : TFA Salts (see option TFA removal)
Peptide library synthesis hepcidin 25 Delivery format : Freeze dried in propylene 2mL microtubes
scrambled cathelicidin peptide Other names : Cathelicidin,All38 peptide,BAC4,CAP18,CAMP , 154947-66-7
peptide library synthesis service Peptide Solubility Guideline
buy peptide price Bulk peptide quantities available

Price

Product catalog Size Price € HT Price $ USD
SB010-1MG 1 mg  127  158
SB010-5*1MG 5×1 mg  440  550

 

References

1- Sheehan,Gerard et al. Infection and immunity vol. 86 ,7 e00097-18. (2018)
The Human Cathelicidin Antimicrobial Peptide LL-37 Promotes the Growth of the Pulmonary Pathogen Aspergillus fumigatus

 

BACKGROUND: The pulmonary mucus of cystic fibrosis (CF) patients displays elevated levels of the cathelicidin antimicrobial peptide LL-37.

OBJECTIVE: Assess the effect of LL-37 on the growth of Aspergillus fumigatus,a common pathogen of CF patients.

METHOD/RESULTS: Exposure of A. fumigatus to LL-37 and its derived fragment RK-31 (1.95 μg/ml) for 24 h had a positive effect on growth (199.94% ± 6.172% [P < 0.05] and 218.20% ± 4.63% [P < 0.05],respectively),whereas scrambled LL-37 peptide did not (85.12% ± 2.92%). Exposure of mycelium (preformed for 24 h) to 5 μg/ml intact LL-37 for 48 h increased hyphal wet weight (4.37 ± 0.23 g , P < 0.001) compared to the control (2.67 ± 0.05 g) and scrambled LL-37 (2.23 ± 0.09 g) treatments. Gliotoxin secretion from LL-37 exposed hyphae (169.1 ± 6.36 ng/mg hyphae , P < 0.05) was increased at 24 h compared to the results seen with the control treatment (102 ± 18.81 ng/mg hyphae) and the scrambled LL-37 treatment (96.09 ± 15.15 ng/mg hyphae). Shotgun proteomic analysis of 24-h LL-37-treated hyphae revealed an increase in the abundance of proteins associated with growth (eukaryotic translation initiation factor 5A [eIF-5A] [16.3-fold increased]),tissue degradation (aspartic endopeptidase [4.7-fold increased]),and allergic reactions (Asp F13 [10-fold increased]). By 48 h,there was an increase in protein levels indicative of cellular stress (glutathione peroxidase [9-fold increased]),growth (eIF-5A [6-fold increased]),and virulence (RNase mitogillin [3.7-fold increased]).

CONCLUSION: These results indicate that LL-37 stimulates A. fumigatus growth and that this stimulation can result in increased fungal growth and secretion of toxins in the lungs of CF patients.T