MT7 – Muscarinic Toxin 7 – Ion Channels and Transporters
Muscarinic toxin 7 (MT7 – m1-toxin 1) has been isolated from the venom of the green mamba (Dendroaspis Angusticeps). MT7 potently blocks M1-subtype of muscarinic acetylcholine receptors at a subnanomolar affintiy. Muscarinic acetylcholine receptors are G-protein coupled receptors that mediate the metabotropic effects of acetylcholine. M1-type muscarinic acetylcholine receptors are well known therapeutic targets to improve cognitive functions in patients with Alzheimer disease. Contrary to many ligands that target mAChRs (pirenzepine, carbamoylcholine chloride, 4-DAMP or atropine), MT7 is the most selective M1-subtype antagonist as it is about 10,000 times more selective for M1-subtype than other subtypes. MT7 toxin is an ideal tool to identify the muscarinic receptor subtype expression in tissues for example. MT7 toxin belongs to the three finger toxin family such as rho-Da1a.
Technical specification
| Sequence : | H-LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK-OH (Cys3-Cys24; Cys17-Cys42; Cys46-Cys57; Cys58-Cys63) | |
| MW : | 7472.43 g/mol | |
| Purity : | > 95% | |
| Counter-Ion : | TFA Salts | |
| Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| MTX007-5 x 0.01 mg | 5 x 0.01 mg | 165€ | 198$ |
If you’d like to learn more about this toxin, visit our product page on our Genpabio website—Our sister company specializing in the synthesis of complex toxins.
