gp96-II
⚡ Custom Synthesis 🔬 HPLC & MS Certified 🌍 Global Delivery

gp96-II

gp96-II – Immunology – Antigens/Epitotes/Pools/Librairies Heat shock protein gp96 inhibitor which binds to and antagonizes gp96 mediated lipopolysaccharide (LPS) induced cytokine production. Anti-inflammatory in a number of in vivo and in vitro models.   Technical specification Sequence : H-LNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY-OH MW : 4.461.6 g/mol Purity : > 95% Counter-Ion : TFA Salts Delivery format : Lyophilized […]

Technical Specifications

Sequence:H-LNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY-OH
Purity:> 95% (by HPLC)
Counter-Ion:TFA Salts
Delivery Format:Lyophilized

Request Custom Quote Email Technical Support


Product Description & Background

gp96-II – Immunology – Antigens/Epitotes/Pools/Librairies

Heat shock protein gp96 inhibitor which binds to and antagonizes gp96 mediated lipopolysaccharide (LPS) induced cytokine production. Anti-inflammatory in a number of in vivo and in vitro models.

 

Technical specification

Sequence : H-LNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY-OH
MW : 4.461.6 g/mol
Purity : > 95%
Counter-Ion : TFA Salts
Delivery format : Lyophilized

Price

 

Product Size Price € Price $
CRB1001377-0.5 mg 0.5 mg 141€ 170$
CRB1001377-1 mg 1 mg 193€ 232$