Glucagon (1-29)-[Lys(AF647)]
⚡ Custom Synthesis 🔬 HPLC & MS Certified 🌍 Global Delivery

Glucagon (1-29)-[Lys(AF647)]

Glucagon (1-29)-[Lys(AF647)] – Fluorescent Peptides Glucagon (1-29)-[Lys(AF647)] is derived from glucagon, which is a peptide hormone secreted by alpha cells located in the islet of Langerhans region of the pancreas. Glucagon is an essential catabolic hormone that is responsible for the regulation of blood glucose levels. Once released into the bloodstream, glucagon stimulates the production […]

Technical Specifications

Sequence:H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT(K/AF647 DBCO)-NH2
Purity:> 95% (by HPLC)
Counter-Ion:TFA Salts
Delivery Format:Lyophilized



Product Description & Background

Glucagon (1-29)-[Lys(AF647)] – Fluorescent Peptides

Glucagon (1-29)-[Lys(AF647)] is derived from glucagon, which is a peptide hormone secreted by alpha cells located in the islet of Langerhans region of the pancreas. Glucagon is an essential catabolic hormone that is responsible for the regulation of blood glucose levels. Once released into the bloodstream, glucagon stimulates the production of hepatic glucose, which means it is considered to be a glucose-mobilizing agent. Excessive levels of glucagon can result in the development of hyperglycaemia, since the action of glucagon results in abnormally high blood glucose levels. This peptide contains AF647, structural analog to Alexa Fluor? 647 which is a widely used far-red fluorescent dye.

 

Technical specification

Sequence : H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT(K/AF647 DBCO)-NH2
MW : 4.750 g/mol
Purity : > 95%
Counter-Ion : TFA Salts
Delivery format : Lyophilized

Price

 

Product Size Price € Price $
CRB1101573-0.1 mg 0.1 mg 282€ 339$
CRB1101573-0.5 mg 0.5 mg 385€ 462$